Gerontology Essays (Examples)

Filter results by:

 

View Full Essay

geriatrics and nursing'shortage

Words: 734 Length: 2 Pages Document Type: Essay Paper #: 55392697

Nursing Students Attitude Towards the Elderly: Literature Review

The changing demographics in many of the populations in industrialized countries has changed the aggregate needs of the nursing workforce and this trend is expected to continue into the future as the population continues to age. One issue that has arisen is that the younger generation of nurses have demonstrated through various means that their preference for their nursing roles within organizations is not for working with the elderly patients. Therefore, a gap exists between the demand for nursing jobs that deal with elderly patients and the supply of nursing students that are willing to fill these positions. This article will look at two research efforts that try to focus on this precise trend and provide information about how this trend could possibly be reversed and finding a more optimal point in the supply and demand for nursing positions in the future.…… [Read More]

Works Cited

Bleijenberg, N., Jansen, M., & Schuurmans, M. (2012). Dutch nursing students' knowledge and attitudes towards older people - A longitudinal cohort study. Journal of Nursing Education and Practice, 1-8.

Haron, Y., Levy, S., Albagli, M., Rotstein, R., & Riba, S. (2013). Why do nursing students not want to work in geriatric care? A national questionnaire survey. International Journal of Nursing Studies, 1558-1565.
View Full Essay

Treating Geriatrics With Despondency Issues

Words: 635 Length: 2 Pages Document Type: Essay Paper #: 71764547

Mr. P is suffering cardiomyopathy, congestive heart failure, 4+ pitting edema, labored breathing, and an inability to stick to a restricted diet or manage his polypharmacy. He is 76-years-old and in a state of declining health. The medical bills are mounting (and indeed have become overwhelming for Mrs. P who has never had to deal with the couple's financial affairs, as they were always taken care of by Mr. P). The couple is depressed/despondent: Mr. P over his inability to understand why God allows him to linger in this condition rather than just take him immediately, Mrs. P over her inability to have a moment of rest outside the home, where she tends to her husband. Life is difficult for the two. This paper will consider the condition of Mr. P, how it affects Mrs. P, and how the situation can be approached so as to provide a high degree…… [Read More]

References

Barry, C. B. (2000). Teaching the older patient in the home: Assessment and adaptation. Home Healthcare Nurse, 18(6): 374.

Connor, S. (2009). Hospice and Palliative Care. CRC Press. Boca Raton, FL: CRC

Press.
View Full Essay

Simulation of Growing Old

Words: 674 Length: 2 Pages Document Type: Essay Paper #: 80702095

Gerontology Experiment

Simulation #1 -- Degenerative Arthritis and Macular Degeneration

In this simulation, I placed Band-aids around the middle joints of my fingers and I wore an athletic wrist support on one hand that severely limited my wrist motion. The Band-aids were tight enough to make it almost impossible to bend my fingers except with considerable discomfort. I also placed a smudge of Vaseline in the center of the lenses of clear protective construction goggles to simulate the loss of center vision associated with age-related macular degeneration. The purpose of this set up was to simulate the types of arthritic symptoms in my hands and wrist that elderly people deal with routinely. The plan was to go about my day at home and encounter some of the problems associated with aging.

Immediately, I encountered difficulty doing my normal morning chores. Brushing my teeth took much longer, made a mess of…… [Read More]

View Full Essay

Successful Aging What Do You

Words: 3063 Length: 10 Pages Document Type: Essay Paper #: 99893583

If anything, such a person may have regrets over having wasted too much of life on impersonal achievements and selfish pursuits.

6. Do you agree that in later life men become more nurturing and women more assertive? What do you think are the findings that could support or challenge that observation?

The observation that men tend to become more nurturing, less competitive, less aggressive, and "gentler" in later life and that women tend to become less emotional and more confident or assertive would seem to be substantially true. That is largely attributable to hormonal changes; specifically, aging males tend to produce much less testosterone and post-menopausal females secrete less estrogen in their later years (Pinker, 2002). Naturally, those hormonal changes would be expected to result in various behavioral changes in areas where human behavior (and gender-specific behavior in particular) are products of the secondary sex hormones (Gerrig & Zimbardo, 2008;…… [Read More]

References

Bearon LB. "Successful Aging: What does the 'good life' look like?" Concepts in Gerontology Vol. 1, No. 3, (Summer 1996).

Birren JE. And Schaie KW. (2006). Handbook of the Psychology of Aging. Burlington,

MA: Elsevier Academic Press.

Gerrig R. And Zimbardo P. (2008). Psychology and Life. New York: Allyn & Bacon.
View Full Essay

Vitamin D Supplementation Increases Voluntary Physical Activity

Words: 1572 Length: 4 Pages Document Type: Essay Paper #: 50924869

Vitamin D Supplementation increases Voluntary Physical Activity Levels in Nursing Home Patients

Over the course of a semester does vitamin D3 supplementation, and the resultant increase in muscle strength and bone density, lead to increased physical activity in nursing home residents in the absence of added encouragement?

The elderly often suffer from low serum levels of vitamin D, reduced muscle strength, and decreased bone density (reviewed in: Hamilton, 2010). Muscle biopsies have revealed that the muscle fibers most affected in the elderly are type II, the 'fast twitch' fibers. When a person begins to fall they instinctively attempt to prevent or break their fall and this reaction depends heavily on fast twitch muscle fibers. The elderly therefore suffer from an increased risk of falling down and bone fractures. Although conclusive evidence has yet to be found that low serum levels of vitamin D cause this condition, there is a large…… [Read More]

Bibliography:

Hamilton, B. (2010). Vitamin D and human skeletal muscle. Scandinavian Journal of Medicine & Science in Sports, 20, 182-190.

Williamson, J.D., Espeland, M., Kritchevsky, S.B., Newman, A.B., King, A.C., Pahor, M., et al. (2009). Changes in cognitive function in a randomized trial of physical activity: Results of the Lifestyle Interventions and Independence for Elders pilot study. Journal of Gerontology, 64A, 688-694.

Semba, R.D., Houston, D.K., Ferrucci, L., Cappola, A.R., Sun, K., Guralnik, J.M., et al. (2009). Low serum 25-hydroxyvitamin D concentrations are associated with greater all-cause mortality in older community-dwelling women. Nutrition Research, 29, 525-530.

European Organization for Research and Treatment of Cancer (2010). QLQ-C30 questionnaire. Retrieved from http://groups.eortc.be/qol/downloads/modules/specimen_20qlq_c30.pdf
View Full Essay

Grumpier Old Men This Movie

Words: 2869 Length: 8 Pages Document Type: Essay Paper #: 22009818

Not only that, the results of eating badly is harmful. Holland and Barrett magazine reports: "If your diet isn't as balanced as you'd hope for, there's a chance you could be missing out on L. Trytophan - an important amino acid that plays a vital role in the production of brain chemicals." If one's diet is lacking it, the safest way to get this supplement is in the form of 5-HTP - a natural compound that the body produces from L-Trytophan. 5-HTP is believed to help the body produce serotonin, a chemical that regulates mood, sleep and other brain-related functions. (Pearce, 1999)

In aging people who seem to have no appetite, there actually may be a sensory dysfunction, which keeps that person from enjoying food and other things that are sensed through taste and smell. Susan S. Schiffman, Ph.D. pointed out that in the elderly these senses are not entirely…… [Read More]

Works Cited

About Dementia. http://www.about-dementia.com/.2006.

Davis, Alison. "Stress -- it might be even worse than you think," a Summary of the Conference "Biology of Stress" co-sponsored by the OBSSR and NIGMS, April 12, 2006.

Huang, Cindy S., et al. "Common Molecular Pathways Mediate Long-Term Potentiation of Synaptic Excitation and Slow Synaptic Inhibition." Cell (Journal), Volume 123, Issue 1, 7 October 2005, Pages 105-118.

Pearce, Gillian. Depression Antidotes Newsletter. Thu, 15 Jul 1999-18:35:21 -0400.
View Full Essay

Senior Citizens as a Vulnerable

Words: 3316 Length: 11 Pages Document Type: Essay Paper #: 48786719

While it is true that in many countries like Canada there has been a reduction in vulnerabilities such as poverty among the elderly, it is equally true that;

some 3.3 million seniors still live below the poverty line Good housing and proper medical care are often out of reach for the poor elderly -- or so expensive that little money is left over for other needs. Hundreds of thousands of elders go hungry every month. (Callahan, 1999, p. 74)

Poverty is however also a strong indicator of elderly vulnerability in Canada; where the lack of resources is also linked to safety and security issues. Many elderly people live alone and they become more vulnerable to abuse and attack if they so not have enough funds to afford adequate home security. As one Canadian resource notes; "Examples include safety devices that would reduce their chances of a fall or an alarm…… [Read More]

References

Abuse of the elderly. Retrieved February 10, 2009, at http://whqlibdoc.who.int/publications/2002/9241545615_chap5_eng.pdf

Ageism: Canadian Network for the Prevention of Elder Abuse. Retrieved February 10, 2009, at http://www.cnpea.ca/ageism.htm

Barer M. And Hertzman C. (1972) on Being Old and Sick: The Burden of Health Care for the Elderly in Canada and the United States. Journal of Health Politics, Policy and Law, 17(4), pp.763-782.

Brownell P., Welty a., Brennan M. Elder Abuse and Neglect. Retrieved February 10, 2009, at http://www.aging.state.ny.us/explore/project2015/artabuse.htm
View Full Essay

Job Opportunities for Health Care Managers in 2020

Words: 976 Length: 3 Pages Document Type: Essay Paper #: 48805443

Job Opportunities for Health Care Managers in 2020

The health care industry is in the United States is on the poise of burgeoning more than it ever has before. There are several factors that directly contribute to this situation that span diverse areas of economics, demographics, technology and behavior and personal lifestyle choices. Virtually all of these facets of contemporary health care result in the fact that people are living longer now than they ever have before. According to the U.S. Bureau of Labor Statistics (2010), "As the large baby-boom population ages and people remain active later in life, the health care industry as a whole will see an increase in the demand for medical services." Much of that demand will be in gerontology, as the previous allusion to the baby-boomer generation indicates. There are several advances in technology that are also contributing to people maintaining their health longer than…… [Read More]

References

Bureau of Labor Statistics. (2010). Medical and health services managers. www.bls.gov.

Retrieved from  http://www.bls.gov/ooh/Management/Medical-and-health-services-managers.htm 

Coombs, B. (2013). Aging baby boomers may find long-term care elusive. www.cnbc.com. Retrieved from http://www.cnbc.com/id/100935149

Wake, M. (2010). Nurses and the Affordable Care Act. American Journal of Nursing. 110 (9): 11.
View Full Essay

Interview Was to Learn the Life of

Words: 1555 Length: 5 Pages Document Type: Essay Paper #: 49739324

interview was to learn the life of Mr. Mike obinson, my 65-year-old retired neighbor from the town next to me, in Sudbury. I selected this person because it will allow me to understand some of the core issues related to aging. My interactions with Mike obinson before this interview were cordial and I believed that his example might shed light on some of the theories of aging we are covering in class. I believe that he is a good example of how aging theories can be applied to help people, because Mr. obinson is aging in a way that is healthy due to his strong social support system and positive attitude on life.

Within this report, I intend to learn about his life conditions as well suggest and inform ways to improve the person's life. After interviewing Mr. obinson on two different occasions, I gained some knowledge on how he…… [Read More]

References

Dowd, J.J. (1975). Aging as exchange. Journal of Gerontology 30(5): 584-594

Havighurst, R.J. (1961). Successful aging. The Gerontologist 1(1961): 8-13.

The Health Authority (2010).

Miller, S.M. & Barrow, G.M (2010). Aging, the Individual, and Society. Cengage.
View Full Essay

Reason I Selected the University of Alabama

Words: 1061 Length: 3 Pages Document Type: Essay Paper #: 16597639

reason I selected the University of Alabama at Birmingham School of Nursing for graduate studies in nursing is because I ultimately seek to become a leader in the field of nursing, and there are several facets of this institution that legitimize its "vision to sustain nursing leadership worldwide." In particular, I was attracted to the synthesis of different disciplines and areas of erudition that the UAB School of Nursing emphasizes as part of its graduate education in this field, which include various aspects of management, economics, information technology, marketing and consultation to equip graduates with the necessary skills to perform as leaders within this profession.

It is increasingly necessary for nurses in advanced positions to utilize evidence-based practices as part of their means to fulfilling their responsibilities. The UAB School of Nursing, with its research center providing funded opportunities to counter some of the most pressing health care issues in…… [Read More]

References

Egenes, K.J. (2012). The nursing shortage in the U.S.: a historical perspective. Chart. 110(4), 18-22.

Harper, D.C. (No date). About our school. www.uab.edu. Retrieved from  http://www.uab.edu/nursing/home/about 

Marelli, T.M. (2013). The good, the bad and the ugly in the changing healthcare landscape: the role of nurse practitioners in meeting increasing demand for primary care (the good), CMS and contractor oversight of home health agencies (the bad), and the sad demise of the Medicaid hospice benefit in Louisiana (the ugly). Home Health Care Nurse. 31(3), 121-123.

UAB Nursing. (2013). Nurse practitioner family primary care. www.uab.edu. Retrieved from  http://www.uab.edu/nursing/home/images/stories/info_sa/MSN_Flyer_NP_Family.pdf
View Full Essay

nursing home anthropology of aging

Words: 2319 Length: 7 Pages Document Type: Essay Paper #: 45153596

Social Construction of Aging in Nursing Homes

Aging is socially constructed. Using the perspective of symbolic-interactionism, it is possible to show the precise processes whereby the social construction of aging takes place inside specific institutional contexts, like the American nursing home. The American nursing home offers insight into the culturally constrained concept of aging, for attitudes towards aging bodies and aging as a philosophical concept are informed by cultural milieu, worldview, and value construction. Biological aging is not social aging. The positive aging movement and the harmonious aging movement offer counterpoints to traditionally antagonistic and negative views of aging. Especially as the population of the United States and other industrialized nations shifts towards the older end of the age spectrum, it becomes important to reconsider the biological, psychological, and social processes and functions of aging.

The nursing home offers the opportunity to examine aging from a multidisciplinary perspective, while using…… [Read More]

References

Bengtson, V.L. & Deliema, M. (2016). Theories of aging and social gerontology. In Gerontology: Changes, Challenges, and Solutions. ABC-CLIO.

Featherstone, M. & Hepworth, M. (1995). Images of positive aging. In Images of Aging. Taylor & Francis.

Gergen, K.J. & Gergen, M.M. (2000). The new aging. Social Structures and Aging. New York: Springer. Retrieved online: http://www.swarthmore.edu/sites/default/files/assets/documents/kenneth-gergen/The_New_Aging.pdf

Katz, S. (2005). Cultural Aging. Canadian Journal of Sociology Online, Jan-Feb 2006. Retrieved online: http://www.cjsonline.ca/pdf/culturalaging.pdf
View Full Essay

Socioeconomic Effects on Aging and

Words: 1450 Length: 5 Pages Document Type: Essay Paper #: 44033938

(Whitaker, 2007)

Dermura, S. (n.d.). he Interrelationship among Achievement Patterns of Activities of Daily Living. Journal of Psychological Anthropology, 167 -- 175.

he article the Interrelationship among Achievement Patterns of Activities of Daily Living, examines the responsiveness rates of those who are disabled and living in a nursing home. o determine this, the author sampled 706 dependent elderly patients. he results were that respondents performed well in activities using the lower parts of their body. his information can be used with corresponding information to examine how the body changes, once someone is forced into an institutionalized situation. At which point, it can be corroborated with the other pieces of information to see the true effects of aging. (Deruma, n.d.)

Mudege, N. (2007). Survival Strategies of Older Men and Women. Journal of Aging Studies, 23, 245 -- 257.

he article, Survival Strategies of Older Men and Women, highlights the different strategies…… [Read More]

The article, Health and Functional Status of Elderly Patients Living in Nursing Homes, looks for common factors that could help contribute to conditions that would increase the chances of some form of dependency, on various assisted living programs when person become older. This was accomplished by looking at 506 elderly men and women living in nursing homes throughout Turin, Italy. What the study found was those who were most commonly from the lower to middle classes within society and are less educated, were most likely to suffer from at least one of these conditions. This information is useful, because it could be used to highlight why particular social / economic classes would most likely to require increased amounts of care when they become older. The source provides information that can be used to help construct the various issues that the elderly must wrestle with. (Molashi, 1995)

Jennett, a. (2003). The Socio Economic Impact of Teleheatlh. University of Alberta. api.ning.com/.../Thesocioeconomicimpactoftelehealthsystematicreview.pdf

The article, the Socio Economic Impact of Teleheatlh, examined the overall economic benefit that a variety of community or government-based health service programs provides to the elderly and their families (such as Social Security of Medicare). This was accomplished through examining 306 different pieces of literature. At which point, the author was able to identify a number of different ways that these programs benefit senior citizens along with their families to include: higher quality care, easy access to a variety of health care services and greater social support. This source
View Full Essay

Non-Pharmacological Pain Relief With Childbirth Dealing With

Words: 787 Length: 2 Pages Document Type: Essay Paper #: 16953236

Non-Pharmacological Pain elief With Childbirth

Dealing with aging dementia patients can be a challenge in and of itself. However, when healthcare providers need to include regulating pain as well, the challenge becomes even greater. Pain management with cognitively impaired patients is a constant problem within geriatric care in modern healthcare facilities (Zwakhalen et al. 2006). The reduced self capacity to report pain in its true degrees then makes pain management a challenge for physicians and healthcare providers (Husebo et al. 2007). Thus, research aims to explore effective measures for observing and reporting pain management within aging dementia patients.

Horgas et al. (2009) is an in-depth examination of the various factors that can be used to report pain within these specific groups of patients. The journal is from the American Geriatrics Society, and thus is clearly peer-reviewed. It is a thorough examination into how dementia patients report their own pain, as…… [Read More]

References

Horgas, Ann L.; Elliott, Amanda F.; & Marsiske, Michael. (2009). Pain assessment in persons with dementia: Relationship between self-report and behavioral observation. Journal of the American Geriatrics Society, 57(2009), 126-132.

Husebo, Bettina Sandgathe; Strand, Liv Inger; Moe-Nilssen, Rolf; Husebo, Stein Borge; Snow, Andrea Lynn; & Ljunggren, Anne Elisabeth. (2007). Mobilization-Observation-Behavior-Intensity-Dementia Pain Scale (MOBID): Development and validation of a nurse-administered pain assessment tool for use in dementia. Journal of Pain and Symptom Management, 34(1), 67-83.

Zwakhalen, Sandra M.G.; Hamers, Jan P.H.; Abu-Saad, Huda; & Berger, Martijn P.F. (2006). Pain in elderly people with severe dementia: A systematic review of behavioral pain assessment tools. BMC Geriatrics, 6(3). Web. http://www.biomedcentral.com/1471-2318/6/3
View Full Essay

Old the Very Late Old

Words: 1780 Length: 5 Pages Document Type: Essay Paper #: 60410136

, 2012). When considering housing for this group it is important to make sure that you do not isolate someone sharing their spiritual or religious beliefs. A social worker who does not keep up with the understanding of the individuals with whom they work could be inadvertently setting up a disaster for such an elderly individual. It is always important to discover, praise, and attend to new developments and changes regarding all aspects of the clients with which the social worker involved.

eferences

Christensen, H. (2001). What cognitive changes can be expected with normal ageing?

Australian and New Zealand Journal of Psychiatry, 35, 768 -- 775.

Escobar-Bravo, M.A., Puga-Gonzalez, D., & Martin-Baranera, M. (2012). Protective effects of social networks on disability among older adults in Spain. Archives of Gerontology and Geriatrics, 54(1), 109-116.

Hodge, D.., Horvath, V.E., Larkin, H., & Curl, a.L. (2012). Older adults' spiritual needs in health care…… [Read More]

References

Christensen, H. (2001). What cognitive changes can be expected with normal ageing?

Australian and New Zealand Journal of Psychiatry, 35, 768 -- 775.

Escobar-Bravo, M.A., Puga-Gonzalez, D., & Martin-Baranera, M. (2012). Protective effects of social networks on disability among older adults in Spain. Archives of Gerontology and Geriatrics, 54(1), 109-116.

Hodge, D.R., Horvath, V.E., Larkin, H., & Curl, a.L. (2012). Older adults' spiritual needs in health care settings: A qualitative meta-synthesis. Research on Aging, 34(2), 131-155.
View Full Essay

Program Budget and Cost Analysis

Words: 4858 Length: 16 Pages Document Type: Essay Paper #: 97749747

Program Budget and Cost Analysis

Line-Item Budget for an in-Service Dementia Care Training Program

Florida now requires all direct-care staff working with dementia patients to receive specialized training. The curricula offered must be vetted by the Training Academy of the University of South Florida's Policy Exchange Center on Aging, otherwise assisted living facilities, nursing homes, adult day care, and hospices will be unable to accept patients with dementia into their facilities. In order to meet these statutory requirements and improve patient care, an in-service training program in dementia care will be instituted for a hospice facility located in Florida.

The Hospice House in Cape Coral, Florida maintains 36 beds for patients with terminal illnesses. On average, a little over 60% of the residents suffer from dementia at any one time, which is consistent with national trends (Williams, Hyer, Kelly, Leger-Krall, and Tappen, 2005, p. 98). The number of patients tends…… [Read More]

References

CMS (Centers for Medicare & Medicaid Services). (n.d.). Hospice Center. CMS.gov. Retrieved 13 Mar. 2012 from www.cms.gov/Hospice/Downloads.2011_Aggregate_Cap.pdf.

Goyder, Judith, Orrell, Martin, Wenborn, Jennifer, and Spector, Aimee. (2012). Staff training using STAR: A pilot study in UK care homes. International Psychogeriatrics, published online ahead of print, p. 1-10. Retrieved 13 Mar. 2012 from http://journals.cambridge.org/action/displayAbstract?fromPage=online&aid=8473487.

Hobday, John, V., Savik, Kay, Smith, Stan, and Gaugier, Joseph E. (2010). Feasibility of internet training for care staff of residents with dementia: The CARES® Program. Journal of Gerontology Nursing, 36, 13-21.

Hyer, Kathryn, Molinari, Victor, Kaplan, Mary, and Jones, Sharmalee. (2010). Credentialing dementia training: The Florida experience. International Psychogeriatrics, 22, 864-873.
View Full Essay

Right to Die Legal and Ethical Issues Concerning the Withdrawal Withholding of Treatment

Words: 2116 Length: 8 Pages Document Type: Essay Paper #: 90932592

Right to Die

For the last few decades, the issue of a person's right to choose the time and method of his or her own death has been one of passionate debate in the United States, with emotions running high on both sides of the controversy as the meanings of liberty and freedom of choice, the morality of taking one's own life, the ethics of people involved in such actions, and the laws related to this issue take center stage in the arguments.

Since civilization began, suicide has existed in one form or another, with varying degrees of acceptance, such as the ancient Greeks who held tribunals for elderly people who requested to die, and if approved, were given hemlock and during the first century B.C. actually held annual banquets where the elderly were allowed to attend and drink poison if they felt they had lived long enough.

Moreover, "traditional…… [Read More]

Works Cited

Brennecke, Shari J. "Right to Die: An Overview" Gerontology Manual. http://otpt.ups.edu/Gerontological_Resources/Gerontology_Manual/Brennecke.html.(accessed 12-03-2003).

Chachere, Vickie. "Judge appoints professor as guardian for brain-damaged woman in Florida." AP Worldstream. November 01, 2003. http://ask.elibrary.com/getdoc.asp?querydocid=1P1:86544618&dtype=0~0&dinst=0&pubname=AP+Worldstream&author=VICKIE+CHACHERE%2C+Associated+Press+Writer&title=Judge+appoints+professor+as+guardian+for+brain%2Ddamaged+woman+in+Florida&date=11%2F01%2F2003&query=Terry+Schiavo+and+the+State+of+Florida%2E&maxdoc=30&idx=2&ctrlInfo=result%3ASR%3Aprod.(accessed 12-03-2003)

Cruzan v. Director, Missouri Dept. Of Health." Citation: 497 U.S. 261 (1990)

Concepts: Right to Die/State Police Powers. http://www.tourolaw.edu/patch/CaseSummary.html.(accessed 12-03-2003).
View Full Essay

Active and Passive Euthanasia in

Words: 2320 Length: 8 Pages Document Type: Essay Paper #: 47727719

136).

A major factor underlying whether active or passive euthanasia is legal is whether the doctor intends to kill the patient or not (Lewis, 2009, p. 126). Rachels hits on the intent piece in one of his constructed examples, "Rather, the other factors - the murderer's motive of personal gain, for example, contrasted with the doctor's humanitarian motivation -account for different reactions to the different cases." The Colombian Constitutional Court actually ruled doctors are negligent if they ignore a terminally ill, competent patient's request for active euthanasia, a position which actually moves closer to Rachels' side of the debate (Michlowski, 2009, p. 192). The Canadian Medical Association's inquiry into Belgian euthanasia included asking about the doctors' "explicit intention of hastening the end of life or of enabling the patient to end his or her own life" (Chambaere et al., 2010, p. 896). This intent underlies the principle of "double effect,"…… [Read More]

Nor do professional associations provide a clear consensus to anyone outside their membership, because they often contradict each other. Many of them disagree with the AMA position Rachels frames his argument in terms of. The American Geriatrics Society (AGS) asserts "Most would choose to live if they had full confidence that the care system would serve them well," and so justifies continued prohibition of voluntary assisted suicide and monetary compensation for the practice thereof, using most of the criteria discussed in my research. On the other hand, the American Psychological Association's assertion that the cognition behind the terminally ill patient's decision to die differs from the logic employed by the clinically depressed in deciding to commit suicide is echoed by the American Public Health Association, the American Academy of Hospice and Palliative Medicine, and the American College of Legal Medicine, who justify their recommendation against the negative associations between suicide and what they describe as "the principles of personal autonomy and free will" on grounds of material difference long recognized by the U.S. Supreme Court (Tucker & Steele, 2007, p. 325).

A fourth commonality that runs through the discussion but with much less prominence is a qualification that a patient's decision can be overridden if euthanasia has significant effects on people other than the patient, although those effects are even more rarely, if ever, defined. The Columbian courts qualified their acceptance of personal autonomy as sovereign under the constitution with the competency requirement but also where the exercise of that autonomy carried only " private nonpublic effects" (Michlowski, 2009, p. 192). The petitioner who brought the Columbian complaint claimed in part that non-voluntary euthanasia ("mercy-killing" to the 1973 AMA) left the doctor free to "end the lives of those who are regarded as an obstacle, a nuisance, or whose health raises high costs" (Michlowski, 2009, p. 186), but the court took it upon itself to generalize this even farther. This 'externality' effect rarely appears in such abstract terms, but runs throughout the research and opinion on the ethics of euthanasia in various guises.

The newer AMA policy statement claims euthanasia "would pose serious societal risks," without elaborating specifically what those may be (1996). Numerous patients have included consideration of their family's emotional pain caused by prolonged terminal illness as a factor leading them to choose euthanasia (Chambaere et al., 2010, p. 897); but fewer overtly discuss the callous topic of monetary expense as a factor in that decision. Tucker and Steele mention that voluntary euthanasia consumers may consider the cost to their estate, but only in passing (2007, p. 322). Campbell (2005, p. 45) claims family concern is justified under some Buddhist and Hindu perspectives if the choice to take life is made out of compassion for
View Full Essay

Daniel Levinson's 1920 Theory the

Words: 598 Length: 2 Pages Document Type: Essay Paper #: 51379660



3. Early adulthood (17-45): characterized by greatest energy and abundance and likewise by greatest contradiction and stress. This is the era of drive, ambition, obligations, and attempts to succeed in all areas of life. Whilst potentially fulfilling, it can also provide enormous bouts of stress.

4. Midlife Transition (40-45): Levinson (in sync with Jung, Erickson, and Ortega) sees this era as constituting a sharp break between early adulthood and middle adulthood manifested by greater focus on others as opposed to self and by a more humane and reflective temperament and perspective.

5. Middle adulthood (40-65): Our biological capacities are somewhat weakened. Our focus transfers from ourselves to others, and we feel a responsibility for the future generation.

6. Late Adult transition (60 +) is a synthesis and linkage of both middle and late adulthood

Levinson defines "life structure" as consisting of the individual's relationship to significant others and/or to significant…… [Read More]

Finally, Levinson suggests that it is imperative to make key choices, form a structure around these choices, and to pursue values and goals. One's key choices are imperative to forming one's destiny.

Source

Levinson, D. (1986). A conception of adult development, American Psychologist, 41, 1, 3-13
View Full Essay

Dysphagia in the Elderly the

Words: 2606 Length: 10 Pages Document Type: Essay Paper #: 26467054

" (Stone, 2006) Treatment is stated by Stone (2006) to be "diagnosis dependent and may be medical or surgical." Practical modifications include simple steps such as crushing of pills or opening of capsules to ease and facilitate swallowing.

The work of Leibovitz, et al. (2007) entitled: 'Dehydration Among Long-Term Care Elderly Patients with Oropharyngeal Dysphagia" states that long-term care (LTC) residents in the nursing home "especially the orally fed with dysphagia are prone to dehydration. The clinical consequences of dehydration are critical. The validity of the common laboratory parameters of hydration status is far from being absolute, especially so in the elderly." (Leibovitz, et al., 2007) it is related however that "combinations of these indices are more reliable." (Leibovitz, et al., 2007) the study reported by Leibovitz et al. is one that assessed hydration status among elderly LTC residents with oropharyngeal dysphagia and in which a total of 28 orally…… [Read More]

Bibliography

Spieker, Michael R. (2000) Evaluating Dysphagia. American Family Physician 14 Jun 2000. Online available at http://www.aafp.org/afp/20000615/3639.html

Marik, Paul E. And Kaplan, Danielle (2003) Aspiration Pneumonia and Dysphagia in the Elderly. Chest. July 2003. Vol. 1224, No. 1. Online available at http://www.chestjournal.org/content/124/1/328.full

Bautmans, I., et al. (2008) Dysphagia in elderly nursing home residents with severe cognitive impairment can be attenuated by cervical spine mobilization. J. Rehabil Med. 2008 Oct;40(9):755-60. PubMed Online available at http://www.ncbi.nlm.nih.gov/sites/entrez?Db=pubmed&Cmd=ShowDetailView&TermToSearch=18843429

Stone, Rebecca S. (2006) Dysphagia in the Elderly. Inpatient Times. October 2006. Online available at  http://www.bmc.org/geriatrics/RStone_DysphagiaintheElderly.pdf
View Full Essay

Reactive Oxygen Species and Free

Words: 2327 Length: 7 Pages Document Type: Essay Paper #: 54025818

The explanation was that a restricted diet would not give enough material for the electron transport chain in the mitochondria to function fully. With fewer electrons to pass, there were also fewer oxygen free radicals produced. Aging, thus, slows down (Nelson).

Proponents of the free radical theory, however, believe that dietary antioxidants are not directly beneficial, as they do not reach mitochondrial DNA (Nelson 2000). The site remains vulnerable and susceptible to attack. However, supplemental antioxidants can indirectly increase lifespan by protecting other cell parts, like cellular proteins and membranes, from injury by free radicals. They still serve a valuable purpose in slowing aging down. The application of the free radicals theory has not reached perfection. Genetic change in achieving increased life span remains controversial and difficult to perform. Dietary restriction is un-attractive to most people and dietary antioxidants do not directly increase life span as they do not access…… [Read More]

Bibliography

Diamond, J., et al. (2002). Free Radical Damage: a Possible Mechanism of Laryngeal Aging. 4 pages. Ear, Nose and Throat Journal: Medquest Communications, LLC

Held, G. (2002). Research into the Aging Process: a Survey. 11 pages. North American Actuarial Journal: Society of Actuaries

Hood, E. (2003). Towards a New Understanding of Aging. 7 pages. Environmental Health Perspectives: National Institute of Environmental Health Sciences

King, a. (2004). Mitochondria-Derived Reactive Oxygen Species Mediates Blue Light-Induced Death of Retinal Pigment Epithelial Cells. 9 pages. Photochemistry and Photobiology: American Society of Photobiology
View Full Essay

Alzheimer's Disease The Onset as

Words: 3283 Length: 8 Pages Document Type: Essay Paper #: 31971086

What is worth noting here is the fact that behavior disturbances, ranging in severity from repeated questioning to physical violence, are common (National Institute of Mental Health, 1989).

It is unclear whether Alzheimer's disease represents a single entity or several variants. Some experts believe that there are distinct subtypes of Alzheimer's disease, such as Lewy body disease (in which the signs of Parkinson's disease, visual hallucinations or alterations in alertness or attention, or all of these symptoms, are conspicuous) and frontotemporal dementia (in which disinhibition, misconduct or apathy, or all of these signs, are prominent). The well-established risk factors for Alzheimer's disease are age, a family history of the disease and Down syndrome (National Institute of Mental Health, 1989).

Confusions about Alzheimer's Disease and the Need for Alternative Actions

There have been numerous studies conducted in relation to Alzheimer's disease. At the same time, there are a number of reports…… [Read More]

U.S. Congress, Office of Technology Assessment. Summary, Confused Minds, Burdened Families: Finding Help for People with Alzheimer's and Other Dementias, OTA-BA-404, Washington, DC: Supt. Of Docs., U.S. Govt. Print. Off., 1990.

Vickrey, Peg Gray-. Advances in Alzheimer's Disease. Nursing: Springhouse Corporation, 2002

Whitehouse PJ. Genesis of Alzheimer's disease. Neurology 1997;48(5 Suppl 7):S2-7.
View Full Essay

Psychological Effects of Aging on African Americans

Words: 1513 Length: 4 Pages Document Type: Essay Paper #: 18138890

Psychological effects of aging on African-Americans

The field of study on the aging process has gained significance in the United States of America in the recent past. The reason for this is that there is a rapid increase in the number of citizens of the United States of America who are above the age of sixty five and the quickest growing age segment is those who are above the age of eighty five years. The population of these two age groups in the United States of America is estimated to be about thirty four million. These figures are expected to rise in a significant manner as the highest fertility period between 1946 and 1964 in the form of the Baby Boomers grow older. It has been estimated that by the year of 2030 the number of citizens of the United States of America over the age of sixty five will…… [Read More]

REFERENCES

Booth, Evangeline. "Chapter 13: The Resiliency of Older Ethnic Minorities" Retrieved from http://www.accd.edu/sac/soci/gpimente/lecture.htm Accessed on March 20, 2005

"Chapter 1: The Growth of Social Gerontology" Retrieved from http://www.accd.edu/sac/soci/gpimente/lecture.htm Accessed on March 20, 2005

Plowden, Keith O. (1999) "Health Behavior of African-American Men" Retrieved from http://www.findarticles.com/p/articles/mi_qa3919/is_199901/ai_n8832886 Accessed on March 20, 2005

Scharlach, Andrew E; Fuller-Thomson, Esme; Kramer, Josea. B. "Curriculum Module on Aging and Ethnicity: African-American Elderly." Retrieved from http://ist-socrates.berkeley.edu/~aging/ModuleMinority1.html Accessed on March 20, 2005
View Full Essay

Sisco Volland and Gorin 2005 Discuss the

Words: 576 Length: 2 Pages Document Type: Essay Paper #: 81582149

Sisco, Volland, and Gorin (2005) discuss the challenge the United States is likely to face in the near future because of the aging population increase alongside the shrinkage of social workers who are capable of caring for older people. Social workers, the authors argue, need to address this problem by learning from the experiences of a few organizations which have been active in this activity. They note that social workers need to carry out broad fund-raising activities, engage the government and the public, and promote educational and training programs to increase the number of social workers who can address the needs of the aging population in the future.

Sisco, Volland, and Gorin (2005) start the article by discussing A Blueprint for the New Millennium, prepared with the support of the Hartford Foundation and the Council on Social Work Education's Strengthening Aging and Gerontology Education for Social Work and aimed at…… [Read More]

References

Sisco, S., Volland, P., & Gorin, S. (November 01, 2005). Social Work Leadership and Aging: Meeting the Demographic Imperative. Health & Social Work, 30, 4, 344
View Full Essay

Anti-Aging Medicine Include Abstract References Scholarly This

Words: 937 Length: 3 Pages Document Type: Essay Paper #: 25837013

Anti-Aging Medicine? Include Abstract eferences scholarly

This is a review of the article titled "Is There an Antiaging Medicine?" which was written by obert N. Butler, Michael Fossel, S. Mitchell Harman, Christopher B. Heward, S. Jay Olshansky, Thomas T. Perls, David J. othman, Sheila M. othman, Huber . Warner, Michael D. West, and Woodring E. Wright. The article was published in the volume 57A, issue no. 9 of the Journal of Gerontology: Biological Sciences in the year 2002 from pages B333-B338. The journal is published by the Gerontological Society of America.

Anti-aging medicine refers to any form of intervention that is given to delay the development of pathology that depends on the person's age and any other changes that are related to age that are not necessarily diseases. All what are there is false claims and bogus remedies which are not known to work. Slowing down the process of aging…… [Read More]

References

Butler, R.N., Fossel, M., Harman, S.M., Heward, C.B., Olshansky, S.J., Perls, T.T., . . . Wright, W.E. (2002). Is There an Antiaging Medicine? Journal of Gerontology: BIOLOGICAL SCIENCES, 57A (9), B333 -- B338.

Weindruch, R., & Walford, R.L. (1988). The Retardation of Aging and Disease by Dietary Restriction. Springfield, IL: Charles C. Thomas.
View Full Essay

Sensation and Perception Specifically the Interaction Between Taste and Smell

Words: 1236 Length: 4 Pages Document Type: Essay Paper #: 24472451

Taste and Smell

Age elated Changes in Perception of Flavor and Aroma

It has been posited that the perception of flavor and aroma are derived from the senses of chemical irritation, taste and smell (awson, 2003).

Together, these senses constitute what has been termed chemosensation, although these sensory systems are purportedly considerably variant in their physiology and anatomy. Nevertheless, they do have the ability to regenerate, and their noted susceptibility to aging and age associated diseases has been noted (awson, 2003). It has been reported that nearly one third of all older individuals report dissatisfaction with their sense of smell and taste, and the actual occurrence of sensory loss amongst the elderly is maintained to be even higher (Pelchat, 2001). Furthermore, it has been asserted that age related sensory loss affects both personal safety and quality of life (awson, 2003). Moreover, the impact of the loss on the elderly's physical…… [Read More]

References

Chodosh, S., et al. (1998). Efficacy and safety of a ten day course of 400 or 600

milligrams of grepafloxacin once daily for treatment of acute bacterial exacerbations of chronic bronchitis: comparison with a ten day course of 500 milligrams of Ciprofloxacin twice daily. Antimicrobial Agents in Chemotherapy, 42(1), 114-120.

Mathey, M., et al. (2001). Flavor enhancement of food improves dietary intake and nutritional status of elderly nursing home residents. Journals of Gerontology: Biological Sciences and Medical Sciences, 56(4), 200-205.

McConnell, R., et al. (1975). Defects of taste and smell in patients with hypothyroidism.
View Full Essay

Secondary Aging Many People Think

Words: 1688 Length: 5 Pages Document Type: Essay Paper #: 51376675



Furthermore, as Baltes makes clear, there are some events that are generally going to impact people at various stages in their lives. For example, an East European Jew who survived World War II would probably have a historical influence that changed other age-expectations, which could impact other longevity factors. Time in a concentration camp, which would be normative for the Jewish cohort in that place and time period, would also likely impact the age of marriage, parenthood, and other culturally normative behaviors that might impact health and longevity in one's old age. While that might seem to be a dramatic example, the reality is that most generations are going to have cohorts impacted by at least one event of similar magnitude. For the practitioner working with geriatric clients, knowing the historical events that are most likely to have impacted the client and how those are likely to interact with the…… [Read More]

References

Anstey, K., Stankov, L., & Lord, S. (1993). Primary aging, secondary aging, and intelligence.

Psychology of Aging, 8(4), 562-70.

Bee, H.L., & Bjorklund, B. (2010). Journey of adulthood, 7th Edition. Upper Saddle River, NJ:

Prentice Hall.
View Full Essay

Mechanism of Aging

Words: 973 Length: 3 Pages Document Type: Essay Paper #: 27707348

Mechanisms of Aging

Mechanism of Aging

Aging is a syndrome that occurs as a result of changes that are progressive, deleterious, universal and therefore, irreversible. This aging damage occurs to the cells, molecules that forms the cells, and to the entire organ. The aging process is most commonly associated with old age diseases such as osteoporosis, arthritis, cancer, heart disease and Alzheimer's disease among others; this is because such diseases are associated with degenerative effects experienced by the cells. Scientist have over the years substituted the word "aging" with "senescence" since aging means that when time elapses so does deterioration takes place which is false especially during the early developmental stage Mackenzie, Bussiere and Tinsley ( 21)

Various researches are being conducted to establish the mechanisms of aging, and as part of these research, experiments have been carried out on various living organism so as to shade more light on…… [Read More]

Works cited

Comfort, Alex. "Biological Aspects of Senescence." Biological Reviews 29.3 (1954): 284-329. Print.

Mackenzie, Danielle K., Luc F. Bussiere, and Matthew C. Tinsley. "Senescence of the Cellular Immune Response in Drosophila Melanogaster." Experimental Gerontology 46.11 (2011): 853-59. Print.

Nigam, Anjana. "Senescence (Ageing) @ 2011." Indian Journal of Dermatology 56.6 (2011): 615-21. Print.
View Full Essay

Hospitalization of Older People Hospitals

Words: 835 Length: 3 Pages Document Type: Essay Paper #: 38946284

.. we have goggles that mimic sight deficits. We use ear plugs, and ways to mimic the tactile changes elderly patients go through. We'll immobilize people, to show what it would be like if they had a stroke, and then ask them to do tasks. It makes them more sensitive to seniors' needs."

In Great ritain, nursing care follows a holistic approach to guiding the aging patient through the hospital stay and into 'step down', cottage hospitals, and community recovery centers. Through an empathetic and geriatric skill set, the geriatric nurse can thereby decrease her ultimate workload while maintaining a higher quality of life for the hospitalized patient.

Summary

Aging is no respecter of persons, countries, or races.

We all age. As a graying generation of millions of 'baby boomers' approach the golden years, medical care must shift much of its focus to the particular needs of this group.

Unlike…… [Read More]

Bibliography

"1999-2008, a 10-year Action Plan for Services for Older Persons," (1998), Eastern Health Board.

Bernard, M. & Phillips, J. (2000), "The Challenge of Ageing in Tomorrow's Britain," Ageing and Society, vol. 20, pp.33-54.

Dickinson E. (1996). "Long-term care of older people," BMJ, vol 312, no. 7035, pp.862-863.

"Fact Files - Ageing in Ireland, National Council on Ageing and Older People," (1997).
View Full Essay

Nursing Home Quality in the

Words: 2026 Length: 7 Pages Document Type: Essay Paper #: 54988994

/nursing homes.

Clearly, since the focus of these articles are based on an institutional economics point-of-view of healthcare quality, a limitation of the study is that it does not take into consideration other variables that might influence the efficiency of nursing homes in providing quality healthcare. Among these unaccounted variables are the politics behind healthcare, specifically federal laws and policies related to the provision of healthcare. Apart from policies and laws, another variables unaccounted for in this study is a thorough look or analysis of the relational dynamics between patients and nurses, as well as other healthcare practitioners and professionals. This variable is vital in understanding the concept of quality healthcare because it provides an in-depth look at the 'experiential" dimension or perspective healthcare -- that is, healthcare quality as assessed by patients and healthcare professionals/practitioners.

In terms of socio-demographic characteristics, the literature collated regarding nursing home care does not…… [Read More]

View Full Essay

Senior Isolation Today Senior Citizens

Words: 1020 Length: 3 Pages Document Type: Essay Paper #: 18674277

According to a recent study, the elderly are hospitalized more often due to alcohol-related problems than for heart attacks (Doup). Another study found some 70% of elderly adults' hospitalizations are related to alcohol, medication, or a mixture of both (Doup).

Many seniors live alone either due to divorce or the death of a spouse, and many more still are retired and have children out of state, and so do not drive as much or as far as before (Doup). This isolation leads many seniors to develop alcohol and drug problems late in life, at a time when they are most vulnerable to medical conditions (Doup). The elderly make up some 11% of the U.S. population, yet they take more than 35% of the drugs prescribed, such as blood pressure medication, sleep medication, and tranquilizers, all of which created a toxic cocktail when mixed with alcohol, causing everything from dizziness to…… [Read More]

Works Cited

Bosworth, Michael F. "Alcohol abuse in the elderly." American Family Physician.

April 1, 1989. Retrieved October 07, 2006 from HighBeam Research Library.

Dooley, Pat. "For Best Nutrition, Elderly Should Socialize, Too."

The Virginian Pilot. July 5, 1996. Retrieved October 07, 2006 from HighBeam
View Full Essay

Articles Seem to Be Saying Same Thing

Words: 1418 Length: 4 Pages Document Type: Essay Paper #: 29870806

articles seem to be saying same thing or do they contradict each other? Is the tone similar in each article, meaning can you tell what the researchers feel about the subject? Do they support the same idea, did they hypothesize similar ideas?

The following are two research essays on the burden of caregivers. The similarities of both essays are that both demonstrate the huge responsibility and unmitigated onus that caregivers carry that consequent in causing them stress and hardship. Differences include the fact that one was carried out on a population in Italy, whilst the other was carried out on a sample in America.

It is striking, too, to note, that although both concluded that caregivers needed more support, the American study recommended ways that individuals could create this for themselves, whilst the Italians-based study placed the responsibility on the community and social work profession. The tone of the articles,…… [Read More]

Sources

Sansoni, J et al. (2004) Anxiety and depression in community-dwelling, Italian Alzheimer's disease caregivers, retrieved from International Journal of Nursing Practice: 10: 93-100.

Hayslip, B et al. (2008) Predictors of Alzheimer's disease caregiver depression and burden: what noncaregiving adults can learn from active caregivers. Educational Gerontology, 34: 945-969, 2008
View Full Essay

Cellular Function and Aging Tumor Suppression Protein

Words: 2307 Length: 6 Pages Document Type: Essay Paper #: 72336870

Cellular Function and Aging

Tumor Suppression Protein 53 and Effects on Cellular Function and Aging

The concept of aging has many intrinsic and extrinsic factors that act as markers on an individual organism. Ignoring mortality associated with external environmental factors, very few organisms can be said to have cellular immortality with no decrease in cellular function or repeat division in normal diploid cells. Cellular senescence is a normal process that halts cellular division after a set of cycles of replication. Senescent cells can remain completely functional but lose the programmed process of replication. The normal pathway for senescent cells is either aging with metabolic pathways continuing for the cell or programmed cell death which is known as apoptosis that occurs when cellular function changes, a specific lifetime is reached for the cell or the cell is damaged. The multicellular cnidarians known as a Hydra has been shown to have a…… [Read More]

References

Cappisi, J. (2005) Senescent cells, tumor suppression and organisimal aging: good citizens, bad neighbors. Cell 120 1-10.

Coppe, J.P. Patil, C.K. Rodier, F. Sun, Y. Munoz, D.P. Goldstein, J. Nelson, P.S. Desprez, P. Campisi, J. (2008) Senescence-Associated Secretory Phenotypes Reveal Cell-Nonautonomous functions of Oncogenic RAS and the p53 Tumor Suppressor. PLOS Biology, 6-12, 2853-2868

Faragher, R.G. (2000) Cell senescence and human aging: where's the link? Biochemical Society Transactions 28 221-226.

Kirkwood, T.B. Austad, S.N. (2000) Why do we age? Nature 408. 233-238.
View Full Essay

Clinical Psychology the Field of Clinical Psychology

Words: 1204 Length: 4 Pages Document Type: Essay Paper #: 19328472

Clinical Psychology

The field of clinical psychology emerged as a viable method through which the theoretical foundations of cognitive studies could be effectively applied within the clinical setting to prevent and treat psychological syndromes. Derived from the first clinical psychology work conducted by Lightner Witmer in the late 19th century, and expanding throughout the 20th century as diagnostic tools were refined and classification systems for mental disorders were standardized, modern clinical psychology has been adapted to fulfill a niche within a whole host of divergent fields, including criminal justice, the social sciences and gender relations. Clinical psychologists premise their work on the use of empirical analysis to accurately investigate matters of cognitive processing, psychological assessment and mental illness, with the administration of personality tests, neurological scans and clinical interviews the most frequently utilized diagnostic resources. As clinical psychology expanded the base of knowledge pertaining to the human brain's highly refined…… [Read More]

References

Blackburn, R. (1993). The psychology of criminal conduct: Theory, research and practice. John Wiley & Sons.

Donohue, J., & Levitt, S. (2001). The impact of race on policing and arrests. Journal of Law and Economics, 44, 367-394. Retrieved from  http://pricetheory.uchicago.edu/levitt/Papers/LevittDonohueTheImpactOfRace2001.pdf 

Fite, P.J., Wynn, P., & Pardini, D.A. (2009). Explaining discrepancies in arrest rates between

Black and White male juveniles. Journal of consulting and clinical psychology, 77(5), 916. Retrieved from  http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2981137/ >.
View Full Essay

Actual Mechanisms Behind the Changes Associated With Aging

Words: 1178 Length: 3 Pages Document Type: Essay Paper #: 77671652

Physiological Changes Associated With Aging

Aging is the complex and inevitable process of tissue and organ system degeneration. Though largely influenced by genetics, aging is also dependent upon a number of environmental factors including exercise, diet, childhood personality, and exposure to ionizing radiation, pollutants, or microorganisms. The physiological changes that occur as an individual's age advances can be grouped into three, with the first category encompassing changes in such homeostatic mechanisms as extracellular fluid volumes, blood, and temperature; the second encompassing changes related to decreasing organ mass; and the third, changes in the body's functional reserve systems. Promoting the health of an aging population is crucial not only because it ensures the well-being of ageing individuals, but also because it significantly reduces the burden imposed upon a country's medical system. It is with this in mind that this text collates knowledge and research to examine, in a deeper sense, the…… [Read More]

References

Bherer, L., Erickson, K.I. & Liu-Ambrose, T. (2013). A Review of the Effects of Physical Activity and Exercise on Cognitive and Brain Functions in Older Adults. Journal of Aging Research, vol. 2013. Retrieved 8 April 2014 from [HIDDEN]

Glassock, R.J. (2009). The GFR Decline with Aging: A Sign of Normal Senescence, Not Disease. Nephrology Times, 2(9), 6-8.

Heckman, G., Gray, L.C. & Hirdes, J. (2013). Addressing Healthcare Needs for Frail Seniors in Canada: the Role of InterRAI Instruments. Canadian Geriatrics Society Journal of CME, 3(3), 8-16.

Saber, A. (2013). Perioperative Care of Elderly Surgical Patients. American Medical Journal, 4(1), 63-77.
View Full Essay

Patient Visits

Words: 725 Length: 2 Pages Document Type: Essay Paper #: 2520737

older patients over the age of 80 due to complications in health such as dementia and depressive symptoms, do not go for additional follow-ups. Yes, the authors explain repeated in person visits help better identify risk factors. There is no obvious research question however they do highlight the use of a study to confirm the hypothesis of whether or not repeated in person follow-ups help with problems experienced as patient's age. "We hypothesized that the type of visit would be related to key demographic, lifestyle, health and function characteristics and that the oldest aged participants would have the poorest retention for in-person visits, particularly clinic visits" (Strotmeyer et al., 2010, p. 697). This is a directional hypothesis because the retention rates are directly associated with increase in age. It is a simple hypothesis because it directly states a cause and effect. The hypothesis was tested and it revealed in-home visits…… [Read More]

References

Strotmeyer, E.S., Arnold, A.M., Boudreau, R.M., Ives, D.G., Cushman, M., Robbins, J.A., Newman, A.B. (2010). Long-Term Retention of Older Adults in the Cardiovascular Health Study: Implications for Studies of the Oldest Old. Journal of The American Geriatrics Society, 58(4), 696-701. doi:10.1111/j.1532-5415.2010.02770.x
View Full Essay

Strotmeyer Et Al 2010 Research Regarding Long-Term

Words: 874 Length: 3 Pages Document Type: Essay Paper #: 90887711

Strotmeyer et al. (2010) research regarding long-term retention of older adults within a given health study. This review will examine the content and structure of this article to determine its practical applications and to reveal key learning points that may be used in future examinations regarding the same topic.

Article Concept

Firstly the aim of this study was to examine the aging population as its demographical influence is described as important and impactful. The object of this study was to understand the idea of retention as it applies to these older people. The article's definition of the word retention is cumbersome and requires some deep thinking to understand the complicated words of the definition. The authors defined retention as "retaining surviving participants enrolled at baseline for subsequent assessments in a longitudinal cohort study." The word "baseline" is never adequately contextualized in this article, requiring the reader to insert some assumptions.…… [Read More]

References

Stotmeyer, E.S., Arnold, A.M., Boudreau, R.M., Ives, D.G., Cushman, M., Robbins, J.A., Harris, T.B., & Newmann, A.B. (2010). Long-term retention of older adults in the cardiovascular health study: Implications for studies of the oldest old. The Journal American Geriatrics Society, 58(4), 696-701.
View Full Essay

Obesity in Elderly Obesity Is

Words: 2155 Length: 6 Pages Document Type: Essay Paper #: 88964438

In addition, those who are emotionally troubled and who are overweight -- often a contributing factor to emotional difficulties -- do not receive extra counseling time." Seale, Seale & Zhang (2008, p.425) This is a serious concern and one that must be addressed immediately by physicians who are providing care for obese patients.

Future

A lot of revamping has to be done to meet this increased need of obese elderly and this has to be done fast. The numbers are increasing by the day and unless some initiatives are taken right away, it can blow up into a full-fledged catastrophe in the future. The first and foremost step that is required is to change the present healthcare system to make it more effective and efficient. Changes have to be made in the delivery of service as well as payments to make it more accessible to the elderly.

Another important step…… [Read More]

References

Arterburn, David E. (2004). The Coming Epidemic of Obesity in Elderly Americans. Journal of the American Geriatrics Society. 52(11). 1907-1912

Odilia I; Bermudez; Tucker, Katherine L. (2001). Total and Central Obesity among Elderly Hispanics and the Association with Type 2 Diabetes. Obesity Research (9), 443 -- 451; doi: 10.1038/oby.2001.58

Thompson, Dennis. (2009, December 31). As U.S. Ages, Health Care May Need to Change. HealthDay Consumer News Service.

Dutton, Drake, D; Engelke. K; McAuliffe, M; Rose, M., (2005). Challenges that nurses face in caring for morbidly obese patients in the acute care setting. Surgery for Obesity and Related
View Full Essay

Health Maintenance Organization Impact on

Words: 13949 Length: 50 Pages Document Type: Essay Paper #: 80930377

" (AAF, nd)

The Health Maintenance Organization further should "…negotiate with both public and private payers for adequate reimbursement or direct payment to cover the expenses of interpreter services so that they can establish services without burdening physicians…" and the private industry should be "…engaged by medical organizations, including the AAF, and patient advocacy groups to consider innovative ways to provide interpreter services to both employees and the medically underserved." (AAF, nd)

One example of the community healthcare organization is the CCO model is reported as a community cancer screening center model and is stated to be an effective mechanism for facilitating the linkage of investigators and their institutions with the clinical trials network. It is reported that the minority-based CCO was approved initially by the NCI, Division of Cancer revention Board of Scientific Counselors in January 1989. The implementation began in the fall of 1990 and the program was…… [Read More]

Principles for Improving Cultural Proficiency and Care to Minority and Medically-Underserved Communities (Position Paper) (2008) AAFP -- American Academy of Family Physicians http://www.aafp.org/online/en/home/policy/policies/p/princcultuproficcare.html

Volpp, Kevin G.M. (2004) The Effect of Increases in HMO Penetration and Changes in Payer Mix on In-Hospital Mortality and Treatment Patterns for Acute Myocardial Infarction" The American Journal of Managed Care. 30 June 2004. Issue 10 Number 7 Part 2. Onlineavaialble at: http://www.ajmc.com/issue/managed-care/2004/2004-07-vol10-n7Pt2/Jul04-1816p505-512

Darby, Roland B. (2008) Managed Care: Sacruificing Your Health Care for Insurance Industry Profits: Questions You must ask before joning an HMO. Online available at: http://www.rolanddarby.com/br_managedhealth.html
View Full Essay

Prescription Nonprescription and Herbal Medications Exploring Interactions in the Geriatric Population

Words: 3992 Length: 12 Pages Document Type: Essay Paper #: 42847416

Prescription, Nonprescription and Herbal Medicines

Prescription, Non-prescription and Herbal Medications: Exploring Interactions in the Geriatric Population

Geriatric medicine, generally referred to as just "geriatrics" is a branch of internal medicine and health care that focuses primarily on the diagnoses, prevention, care and treatment of disease and disability in elderly patients. Elderly patients involve those senior members of the population that develop a disability, or are suffering from a disease that is a resultant of old age or is a prompt symptom of old age. Geriatrics commonly involves treatment of these old age symptoms and disabilities such as deteriorated memory, immobility, impaired vision and hearing etc. Geriatrics, in modern times, is quite advanced. Specialized services such as psycho-geriatrics, where expert psychologists focus on treating old age related depression, memory loss and other psychological conditions that occur in the elderly population, along with development of physical therapy centers whose prime focus is…… [Read More]

Bibliography

Administration on Aging, U.S. Department of Health and Human Services. (2004). A Profile of Older Americans: 2004. Pg. 3,.

Alavijeh, M.S., Chishty, M., Qaisar, Z.M., & Palmer, A.M. (2005 October). Drug Metabolism and Pharmacokinetics, the Blood Brain Barrier, and Central Nervous System Drug Discovery. NeuroRx, 2(40.

Aschenbrenner, D.S., & Venable, S.J. (2009). Drug Therapy in Nursing. Wolters Kluwer- Lippincott, Williams & Wilkins.

George, J., Byth, K., & Farrell, G. (1990). Age But Not Gender Selectively Affects Expression of Individual Cytochrome P450 Proteins in Human Liver. Pub Med- Biochem Pharmacol, 48:365-374.
View Full Essay

nursing manuscript revision edits

Words: 2291 Length: 2 Pages Document Type: Essay Paper #: 88457460

Manuscript Discussion

The Grade Experience of Online Nurse Practitioner Students Who Took More Than One Clinical Course Per Quarter

The shortage in primary care physicians has increased the demand for nurse practitioners (NPs). Online NP programs are of interest to working students with other personal and professional life demands. This study examines grade experience differences for students of an online NP program who took more than one clinical course per quarter (OCCPQ) as compared to those who did not take more than OCCPQ. This retrospective study consisted of 3,760 NP students who graduated between fall 2013 through spring 2016. Those who took more than OCCPQ had a greater percentage of clinical course failures at first attempt as compared to those who did not take more than OCCPQ (2.1% versus 0.8%, p=0.001). Multivariate logistic regression adjusting for relevant covariates maintained these results with increased odds for clinical course failures for those…… [Read More]

View Full Essay

Diversity in the Elderly Population Elderly There

Words: 1013 Length: 3 Pages Document Type: Essay Paper #: 25357428

Diversity in the Elderly Population

Elderly

There is an abundance of diversity of the newest elderly generation. There is a lack of diversity in the health care coverage for the elderly. This would not exist in the future of health care. It is simply not practical nor ethical to ignore this issue of geriatrics as part of the visualization of the future of health care. Subtracting ethics for those who do not care about the elderly, on a practical level, soon there will be too many elderly around to ignore them and their needs. They will likely become an increasing voice of influence on issues such as this one and others, if only because of their great numbers. Those numbers are projected to continue to escalate.

This author imagines a future of health care where all elderly people have access to free, low cost, or subsidized quality health care. In…… [Read More]

References:

America Geriatric Society. (2005). Caring for Older Americans: The Future of Geriatric Medicine. Journal for Aging Geriatric Society, 53(6), S245 -- S256.

Institute of Medicine of the National Academies. (2008). Retooling for an Aging America: Building the Health Care Workforce. Web, Available from: ReportBriefRetoolingforanAgingAmericaBuildingtheHealthCareWorkforce.pdf. 2014 February 03.

The Economist Intelligence Unit. (2009). Healthcare strategies for an ageing society. The Economist, Web, Available from:  http://graphics.eiu.com/upload/eb/Philips_Healthcare_ageing_3011WEB.pdf . 2014 February 03.
View Full Essay

Healthcare for Latinos and African Americans New Challenges

Words: 3430 Length: 10 Pages Document Type: Essay Paper #: 23577326

Diversity of Aging Population -- Innovative Healthcare

Over the past several decades there has been an avalanche of research and scholarly narratives focusing on the aging of millions of Americans -- among them the "baby boomers" that were born between 1946 and 1964 -- including their numbers and their health vis-a-vis the impact on the sometimes struggling healthcare system. But there has been a dearth of research on how American healthcare services will respond -- and is currently responding -- to an increasingly diverse older population when it comes to racial, cultural and ethnic identities. This paper points to the numerous issues and challenges that not only face an increasingly diverse older American population when it comes to healthcare, but also the challenges that the healthcare system itself faces as these Americans move into the twilight of their lives.

hat should be the Vision and Mission of Healthcare Professionals in…… [Read More]

Works Cited

Administration on Aging. (2010). A Statistical Profile of Black Older Americans Aged 65+.

Retrieved April 2, 2014, from  http://www.aoa.gov .

Bookman, A. (2008). Innovative models of aging in place: Transforming our communities for an aging population. Community, Work & Family, 11(4), 419-438.

Centers for Disease Control and Prevention. (2007). The State of Aging and Health in America
View Full Essay

Nurse Leaders and the Care of the Aged

Words: 1319 Length: 3 Pages Document Type: Essay Paper #: 54028572

Career Interest: Gerontology

The research topic of interest or priority is the identification of the skills and knowledge most critical to leaders of health care organizations, such as accountable care organizations, health care homes, medical homes, and clinics, specifically serving the aging population. In particular, this focuses on teamwork among nurse leaders, nurses and other healthcare professionals, current status of research work, the barriers in collaboration, inadequacies and proposed solutions to these inadequacies in order to increase healthcare professionals' ability to serve aging clients more productively. Gerontology is the science of aging and the problems of aging.

Current Status of Research

Studies now focus on the effects of lifestyle factors, physical and mental activity, social interactions, and nutrition on cognitive functions in the aging (Williams & Kemper, 2010). These studies are able to provide initial evidence that physical and mental activity, satisfying social support, and a balanced diet support cognitive…… [Read More]

BIBLIOGRAPHY

Annweller, C et al. (2015). Vitamin D and cognition in older adults: updated international recommendations. Vol. 277, # 1 Journal of Internal Medicine. Retrieved on September 7, 2015

from http://www.ncbi.nlm.nih.gov/;ubmed/24995480

Dwyer, D. (2011). Experiences of registered nurses as managers and leaders in residential aged care facilities: a systematic review. Vol 9 # 4, International Journal of Evidence-Based

Healthcare. Retrieved on September 7, 2015 from http://www.ncbi.nlm.nih.gov/pubmed/22093388
View Full Essay

Interview with a Professional Nurse

Words: 773 Length: 3 Pages Document Type: Essay Paper #: 26689089

Masters in Nursing Overview

The person selected for this interview is my mentor, an advanced nurse practitioner who specializes in geriatrics. She said she began her nursing career by graduating with a bachelor's degree in nursing at the University of California at Berkeley. The program at Berkeley well prepared her for her initial role as a registered nurse. While in school, she mentioned, she was able to procure an internship in the healthcare field which helped her confirm that she actually wanted to have a career as a nurse. After working as a registered nurse for approximately five years, she decided to earn a Master's of Science in Nursing so that she could become an advanced nurse practitioner. To her delight, after earning her degree from the University of California at Berkeley approximately 10 years ago, she was able to obtain a position at Kaiser Hospital in Oakland as an…… [Read More]

View Full Essay

Healthcare System in the United

Words: 5160 Length: 17 Pages Document Type: Essay Paper #: 81713320

However, despite the development of these exemplary healthcare capacities, the UAE's system continued to suffer during this timeframe from a perception among the population that it lacked quality (Kronfel, 1999).

It cannot be discounted that the public may perceive the UAE's healthcare system as lacking in quality because the system does in fact have many developmental issues left to resolve. For example, a study by Margolis (2002) found that as healthcare rapidly expanded in the 1990s, statistically significant numbers of incidents of inappropriate medicine prescription also increased. This finding gave some validity to the concern about quality. However, the majority of the studies reviewed indicated that the UAE's healthcare system was comparable to the healthcare systems in most other developed and developing nations. For example, Margolis et al. (2003) conducted a survey analysis of elderly in the U.S. And the UAE and found that the system of elderly care in…… [Read More]

World Health Organization, (2000). The World Health Organization's ranking of the world's health systems. [24 August, 2009]. Retrieved from  http://www.photius.com/rankings/healthranks.html  (15 January 2010).

Wuyi, W., Ribang, L., Yongfeng, L., Linsheng, Y., and Jianan, T. (2004). "Regional comprehensive assessment on environmental health of China," Journal of Geographical Sciences 14(2): 187-192.

Ypinazar V., and Margolis, S., (2006). "Delivering culturally sensitive care: the perceptions of older Arabian Gulf Arabs concerning religion, health, and disease." Qualitaitive Health Research, 16(6): 773-787.
View Full Essay

Vitamin D Supplementation Safety and Concentration

Words: 1696 Length: 5 Pages Document Type: Essay Paper #: 28980052

Vitamin D Supplementation

Vitamin supplementation has long been a popular way of ensuring that people receive the sufficient amount of vitamins. However as it pertains to Vitamin D, there is some amount of controversy as it pertains to Vitamin D supplementation (25-hydroxy) concentration and safety. The literature review will discuss the need for vitamin D supplementation and the findings of various studies and Vitamin D trials.

An article entitled "Vitamin D supplementation, 25-hydroxyvitamin D concentrations, and safety" the daily allowance of vitamin D is 200 IU. The medical community has established that this amount will prevent the softening of the bones known as osteomalacia. However, there is also a consensus that more vitamin D is need to avoid other conditions such as hyperparathyroidism and osteoporosis.

In fact an article found in the Archives of Gerontology and Geriatrics confirms that the proper amount of vitamin D can reduce the chances of…… [Read More]

Works Cited

ALA-HOUHALA, M., T KOSKINEN, A TERHO, T KOIVULA, AND J. VISAKORPI. Maternal compared with infant vitamin D Supplementation. Archives of Disease in Childhood, 1986, 61, 1159-1163

Alouf B., MD and Grigalonis M. Incidental Finding of Vitamin-D Deficient

Rickets in an Otherwise Healthy Infant -- A Reappraisal of Current Vitamin-D Supplementation Guidelines. Journal of the National Medical Association. VOL. 97, NO. 8, AUGUST 2005

Bjorkman, Mikko. Sorva A., Rejo Tilvis. Responses of parathyroid hormone to vitamin D supplementation: A systematic review of clinical trials. Archives of Gerontology and Geriatrics 48 (2009) 160-166
View Full Essay

Restraints as the Mean Age

Words: 2585 Length: 8 Pages Document Type: Essay Paper #: 9820686

Another study surrounding the use of restraints in non-psychiatric patients (Strumpf and Evans, 1998) reported that the nurses had difficulty reconciling the administration of restraints with concerns regarding patient dignity and autonomy. So it appears that the use of restraints is difficult on staff and patients alike. Interestingly enough, in a literature review for this paper, the writer could find no significant supporting data to recommend restraint devices as effective in the management of the confused or persistently agitated patient. In this case, it appears that many times patients are being placed into restraints more "because we have always done so with this kind of patient" rather than on the basis of any science that the use of restraint is beneficial to the patient.

Restraints and the Law

Any time a patient is to be considered for the application of restraint devices, it is important that all members of the…… [Read More]

Bibliography

Castle, NG, Mor V. (1998) Physical restraints in nursing homes: A review of the literature since the Nursing Home Reform Act of 1987) Nursing Home Reform 55:139-176.

Catchen, H. (1983). Repeaters: Inpatient accidents among the hospitalized elderly. The Gerontologist, 23, 173-176.

Difabio, S. (1981). Nurses' reactions to restraining patients. American Journal of Nursing, 81, 973-975.

Evans, L.K., & Strumpf, N. (1989). Tying down older persons: A review of the literature on physical restraints. Journal of the American Geriatrics Society, 37, 6-14.
View Full Essay

Human Figure Drawing by Koppitz

Words: 1583 Length: 5 Pages Document Type: Essay Paper #: 59391672

Human Figure Drawing

Testing has become an integral part of psychological theory and practice. Rooted in historical perspectives and heated conversation of principles, wagering purpose and ethics, it involves the statistical conceptualizations of psychometrics and the connection of the validity of a test to the reality of a person. The field of psychological testing is characterized by the use of small samples to apply larger generalizations to a specific individual; samples of behavioral trends combine with observations over a limited time in which performance of prescribed tasks is compared to a the pre-studied responses of members of a norm group. These responses, compiled and analyzed before compared to the studied individual, are often crafted into statistical tables that allow the evaluator to compare the behavior of the specific person to the range of responses given by the norm group and make appropriate personality discussions therein. A common type of psychological…… [Read More]

Plubraarn and Theermonparp, p. S615.

Sturner, R.A., Rothbaum, F., Visintainer, M., Wolfer, J. "The Effects of Stress on Children's Human Figure Drawings." Journal of Clinical Psychology. Vol. 36, No. 1. January,1980. p. 324.

Wang, H., Ericsson, K., Winblad, B., Fratiglioni, L. "The Human Figure Drawing Test as a Screen for Dementia in the Elderly: A Community-Based Study." Archives of Gerontology and Geriatrics. Vol. 27, No. 1. August, 1998. p. 25.
View Full Essay

Analyzing the Elderly Falls

Words: 1115 Length: 3 Pages Document Type: Essay Paper #: 62674452

Elderly Falls

With the help of a thorough clinical evaluation, the risk factors, risks associated with falling and working out adequate intervention methods to curb the rate of elderly falls can be achieved. As per the 2011 AGS / BGS guidelines, (Panel on Fall, 2011) certain particulars need to be incorporated in a particular clinical evaluation: 1: Patient history, physical examination, mental and physical functionality; 2: Number of falls occurring, number of medications taken; issues regarding mobility, balance and gait; blurred eyesight; various mental disabilities; weak muscular strength; uneven heartbeat and rhythm; postural hypotension; problems in feet and risks related to environment (Shubert, 2014).

Strategies to Prevent Elderly Falls and Health elated Consequences

Assistive Devices and Other Protective Equipment: Appropriate footwear is required for particular conditions, for instance, wintery weather necessitates anti-slip shoes whilst warmer weather requires cleated footwear, facilitating decreased falls (Panel on Fall, 2011).

Clinical Disease Management (Acute…… [Read More]

References

Clemson, L., Mackenzie, L., Ballinger, C. & Close, J.C.T. (2008). Cumming RG. Environmental interventions to prevent falls in community-dwelling older people: A meta-analysis of randomized trials. J Aging Health. 20(8):954-971.

Gillespie, L.D., Robertson, M.C., Gillespie, W.J., Lamb, S.E., Gates, S., and Cumming, R.G. (2009). Interventions for preventing falls in older people living in the community. Cochrane Database Syst Rev. (2), Art.No.: CD007146

Panel on Fall prevention in Older Persons, American Geriatrics Society and British Geriatrics Society, (2011). Summary of the Updated American Geriatrics Society/British Geriatrics Society Clinical Practice Guideline for Prevention of Falls in Older Persons. J Am Geriatr Soc.;59(1):148-157.

Scott V, Gallagher E, Higginson A, Metcalfe S, & Rajabali F. (2011). Evaluation of an evidence-based education program for health professionals: The Canadian Falls Prevention Curriculum (CFPC). Journal of Safety Research. 42(6):501-507.
View Full Essay

Preventing Unnecessary Hospital Readmissions

Words: 5603 Length: 5 Pages Document Type: Essay Paper #: 61470120

causes for Medicare and Medicaid patients to be readmitted to hospitals within thirty days of a prior discharge. This is a fairly pervasive and major problem and it is one that demands solutions. As part of this capstone, there will be a number of facets and tools used. There will be a problem description that identifies what the problem is and why it is important. There will be a solution description that broadly asserts what is needed to address and resolve the problem identified. There will be an implementation plan that will lay out how the program will be rolled out to the locations and the people that work therein. There will also be an evaluation plan that will be used to monitor and assess performance so that any deficiencies can be spotted and addressed before they become full-on conflagrations that can sap the performance and outcomes of the project.…… [Read More]

References

Challen, L., Kelso, C., & Gandi, B. (2014, May). Association between prescription drug benefit and hospital readmission rates. Hospital Pharmacy, 49, 449-454. http://dx.doi.org/http://dx.doi.org.library.gcu.edu:2048/10.1310/hpj4905-449

Cisneros, F. F. (2015). Transformational Tool Kit for Front Line Nurses, an Issue of Nursing Clinics of North America. London: Elsevier Health Sciences.

Communication and dissemination strategies to facilitate the use of health and health care evidence. (2013). Retrieved from http://effectivehealthcare.ahrq.gov/index.cfm/search-for-guides-reviews-and-reports/?productid=1208&pageaction=displayproduct#toc

Costantino, M. E., Frey, B., Hall, B., & Painter, P. (2013, November 5). The influence of a postdischarge ntervention on reducinghospital readmissions in a Medicare population. Population Health Management, 16(5), 310-316. http://dx.doi.org/http://dx.doi.org.library.gcu.edu:2048/10.1089/pop.2012.0084
View Full Essay

Analysing the Quality of Life Concept

Words: 3154 Length: 9 Pages Document Type: Essay Paper #: 29442670

Nursing Theory

The theory of nursing is built in a dynamic process that develops from practice and is normally reproduced through research, by development and analysis of concepts and theories. There is need to investigate further the phenomena seen in nurses' experience during practice in order to identify the attributes. The most effective way of enabling nurses to deeply examine some phenomena is by defining a concept of interest. This would enable the development of theories that are directly related to a clinical practice. There has been a tremendous improvement and push for the analysis and development of nursing concepts mainly because researchers have attempted to clarify problems that were previously considered as common sense. The increase has been necessitated by concepts that look obvious having vague terminologies, inconsistent theories, and ambiguous definitions.

Quality of life is a terminology that is frequently used in nursing practice and in health care.…… [Read More]

References

Lok, N., Lok, S., & Canbaz, M. (2017). The effect of physical activity on depressive symptoms and quality of life among elderly nursing home residents: Randomized controlled trial. Archives of gerontology and geriatrics, 70, 92-98.

Mishra, S. I., Scherer, R. W., Snyder, C., Geigle, P., & Gotay, C. (2014). Are exercise programs effective for improving health-related quality of life among cancer survivors? A systematic review and meta-analysis. Paper presented at the Oncology nursing forum.

Mjorud, M., Rosvik, J., Rokstad, A. M. M., Kirkevold, M., & Engedal, K. (2014). Variables associated with change in quality of life among persons with dementia in nursing homes: a 10 months follow-up study. PLoS ONE, 9(12), e115248.

Nikmat, A. W., Hawthorne, G., & Al-Mashoor, S. H. (2015). The comparison of quality of life among people with mild dementia in nursing home and home care -- a preliminary report. Dementia, 14(1), 114-125.
View Full Essay

Nursing Literature Review Nursing Mccarthy A Shaban

Words: 1507 Length: 4 Pages Document Type: Essay Paper #: 7975583

Nursing

Literature Review (Nursing)

McCArthy, A., Shaban, R., oys, J., & Winch, S. (2010). Compliance, normality, and the patient on peritoneal dialysis. Nephrology Nursing Journal, 37(3), 243-251.

Key Words, data bases, limitations: compliance, gerontology, medication compliance

Alexandra McCarthy, Ramon Shaban, Jennifer oys & Sarah Winch

"Compliance, normality, and the patient on peritoneal dialysis."

Journal: Nephrology Nursing Journal

Volume: Issues: Pages: 2010: 37: 3: 243-251.

Qualitative

Location/Setting: Case study completed within the ambulatory dialysis of a large metropolitan hospital in Australia.

Independent Variable: PD compliance

Dependent variables: influence on compliance (professional advice regarding PD)

Controlled Variable: none noted

Framework Theory:

The case study utilizes empirical inquiry to investigate contemporary phenomenon within real life context. Phenomenology can be a component of case study theoretical analysis.

Study Design:

Case Study

Sample:

Sample Size: 5 patients identified by renal nursing staff within the clinic were asked to identify patients they considered to be compliant…… [Read More]

Bibliography

Stake, R. (1995). The art of case research: Design and methods (2nd ed.). Thousand Oaks,

CA: Sage Publications.
View Full Essay

Drivers Test Elderly Due to the

Words: 4532 Length: 14 Pages Document Type: Essay Paper #: 40255241

For instance, a decline in peripheral vision may impact the ability to pass approaching vehicles safely, and the decreased range of motion in an older person's neck may impair the ability to look behind when backing up. Also, reaction time decreases by almost 40% on average from age 35 to 65 (Jackson, 1999).

It also appears that the aging process may affect cognitive skills. Short-term memory loss, for instance, can decrease driving skills by interfering with an individual's ability to process information effectively when merging onto a highway into traffic or changing lanes. Such issues are magnified when driving under stressful situations. The higher incidence of cognitive impairment, particularly dementia, among older men and women leads to an increased risk of accident involvement (Jackson, 1999).

According to AAP, as a group, persons age 65 and older are relatively safe drivers. Although they represent 14% of all licensed drivers, they are…… [Read More]

References

Bedard, M., Stones, M., Guyatt, G. & Hirdes, J. (2001). Related fatalities among older drivers and passengers: past and future trends. The Gerontologist. 41 (6), 751-57.

Beers, M.H. & Berkow, R. (eds.) (2000) the Merck Manual of Geriatrics. 3rd ed. Whitehouse Station, NJ: Merck & Co.

Central Intelligence Agency (1998). World Fact Book Washington, D.C.: Government

Printing Office.
View Full Essay

Hospital Acquired Infections Popularly Known as the

Words: 1713 Length: 5 Pages Document Type: Essay Paper #: 3869727

hospital acquired infections, popularly known as the nosocomial infections in adults, specifically elderly adults. In this research paper, the focus is built on infections caught by elderly people and the preventions that can be taken as measures to eradicate the causes of this infection. esearch reports have been taken as references to describe the current situation of nosocomial infection spread in the American society and all over the world.

This infection is developed in a person after a visit to hospital within 48 hours or by patients who are discharged from the hospital and are diagnosed within 30 days of leaving the hospital. Patients who are diagnosed with such an infection carry diseases that are caused by fungal infections or through unsanitary conditions of the hospital environment (Norton, Barie, & Bollinger, 2008). Moreover, they catch infection through contamination from air droplets via sneezing or coughing and from contact with patients…… [Read More]

References

Allen, J.E. (2011). Nursing Home Administration. New York: Springer Pub.

Katlic, M.R. (2011). Cardiothoracic Surgery in the Elderly. New York; London: Springer.

Nelson, K.E., & Williams, C.M. (2007). Infectious Disease Epidemiology. Sudbury, Mass.; Toronto: Jones and Bartlett Publishers.

Norton, J.A., Barie, P.S., & Bollinger, R.R. (2008). Surgery: Basic Science and Clinical Evidence. New York, NY: Springer.
View Full Essay

Nursing Scholarship I Have a Burning Desire

Words: 550 Length: 2 Pages Document Type: Essay Paper #: 37040390

Nursing Scholarship

I have a burning desire to work with homebound geriatrics and pediatric oncology. The compassion to help people, especially elderly and children, the belief in the ability to achieve these goals, and the unfortunate experience of my daughter losing a classmate/friend after battling cancer for eight long years has led to a deeply, burning desire to obtain nursing licensure and work with these types of people. My goals after obtaining nursing licensure is to work part time with homebound geriatrics and fulfill a commitment made to the mother of my daughter's friend in helping children with cancer in the memory of her daughter.

For the past few years, I have worked as an EMT in an overnight summer camp with 1500 children and 65 staff families. The work I do there involves working close with the Pediatrician that visits the camp four times a week, and treating children…… [Read More]

View Full Essay

Student Training in Aged Care What Factors

Words: 2115 Length: 8 Pages Document Type: Essay Paper #: 59425745

Student Taining in Aged Cae

What Factos in Students Taining Enhance Retention

Post Placement in the Aged Cae Secto?

What Factos in Students Taining Enhance Retention

Post Placement in the Aged Cae Secto?

Thanks to medical eseach, bette povision of medical assistance and inceased lifestyle options, individuals ae living longe and in bette health than pevious geneations; howeve, the Austalian population continues to age, lagely due to deceasing bith ates and inceased life expectancy. Not supisingly, this will have an impact on the health cae system. Specifically, the aged cae secto of healthcae equies committed and competent wokes to meet wokplace needs. Unfotunately, Fagebeg & Ekman's (1997) study (as cited in Abbey et al., 2006) shows that the numbe of nusing gaduates willing to assume employment in the aged cae secto is alamingly low. Fo one o moe easons, it appeas that many students ae eithe unwilling to ente this…… [Read More]

references after a gerontology curriculum. Educational Gerontology. 21(3), 247-260.

Australian Department of Health and Ageing. (2002). Recruitment and Retention of Nurses in Residential Aged Care. Final Report. Canberra: Commonwealth Department of Health and Ageing.

Babbie, E. (2007). The practice of social research (12th ed.). Belmont, CA: Wadsworth Cengage Learning.

De la Rue, M. (2003). Preventing ageism in nursing students: An action theory approach. Australian Journal of Advanced Nursing, 20(4), 8-14.

Fagerberg, I. & Ekman, S. (1997). First-year Swedish nursing students' experiences with elderly patients. Western Journal of Nursing Research, 19(2), 177-189.
View Full Essay

Successful Aging as Viewed by Generation X

Words: 3822 Length: 12 Pages Document Type: Essay Paper #: 71404341

successful aging as viewed by Generation X versus Baby Boomers over the age of

Successful Ageing: Generation X versus Baby Boomers

Numerous studies have focused on understanding and defining the constituents of successful aging. The term "successful aging" is popular in the gerontological literature to cover processes in aging. The processes of aging are positive, and at times, the term has shown relations to "vital aging" or "active aging" implying that later life is characterized by sustained health and vitality. According to Moody (2005), "successful aging" suggests main ideas including life satisfaction, longevity, freedom from disability, mastery, and growth, active management with life and independence.

According to Dubey et al. (2011), as people grow older, they have incidences of illnesses. However, an older population has numerous needs as compared to a younger population. Life satisfaction continues to be an important aspect in the study of aging. This is because it…… [Read More]

References

AARP. (2007). Leading a multi-generational workforce. Retrieved from  http://assets.aarp.org/www.aarp.org_/cs/misc/leading_a_multigenerational_workforce.pdf 

Berkman, L., Unger, J.B., McAvay, G., Bruce, M.L., Seeman, L., (1999). Variation in the impact of social network characteristics on the physical functioning in elderly persons.

The Journals of Gerontology, 54(B), 245-251

Bovbierg, V.E., McCann, B.S., Brief, D.J., Follette, W.E., Retzlaff, B.M., Dowdy, A.A.,
View Full Essay

Pet Ownership and Health Benefits Among Older

Words: 1745 Length: 5 Pages Document Type: Essay Paper #: 30026159

Pet Ownership and Health Benefits among Older Adults

There is a general believe that owning a pet provides health and mental benefits for older people, and health benefits include psychological well-being and improved physical health. It is also assumed that pet owners have higher extraversion and lower neuroticism compared to older people without pets. However, findings on this research are still inconclusive because some group of researchers believe that owning pets deliver health benefits to older people while some researchers believe that older people derive no benefits from owing pets. The research carries out an investigation to enhance a greater understanding on whether health benefits can derived from owing pets.

Survey Background

The study examines the relationships between pet ownerships and health benefits among 2,511 sample older adults using the PATH (Personality and Total Health). Information obtained from participants consisted of whether or not participants own one or more pets.…… [Read More]

REFERENCES

American Pet Products Association.2009. National Pet Owners Survey. www.americanpetproducts.org/pubs_survey.asp

Cherniack, E.P. & Cherniack, A.R. 2014. The Benefit of Pets and Animal-Assisted Therapy to the Health of Older Individuals. Current Gerontology and Geriatrics Research.

Groves, Robert M., Floyd J. Fowler Jr., Mick P. Couper, James M. Lepkowski, Eleanor Singer, and Roger Tourangeau. 2009. Survey Methodology. 2nd ed. Wiley Series in Survey Methodology. Hoboken, N.J: John Wiley & Sons. http://www.worldcat.org/oclc/753874406

National Institute of Health. 1987. The health benefits of pets. Workshop summary. Office of Medical Applications of Research.
View Full Essay

Older Adult Assessment Maslow's Hierarchy

Words: 1934 Length: 4 Pages Document Type: Essay Paper #: 89180451

He is still deeply in love with his wife, as though he just met her . He expresses his love on a daily bases with his wife, with hugs, kisses, and showers her with lavish gifts . They cuddle in the evenings in the family room for an evening of relaxation watching television or reading . Although the sexual physical part of their life as slowed down, they still do have a very high sexual relationship which is shown in different ways or expressions .

Fears / Concerns

Mr. P expressed his biggest concern related to aging is being without his wife one day . He also expressed that he doesn't want to die the same way this mother did with Alzheimer's disease, as it was a horrible experience for anyone to live with and watch a loved die . This has played on his mind as he has aged,…… [Read More]

Buchman, a., Boyle, P., Wilson, P., Fleischman, D., Leurgans, and Bennett, D. ( 2009). Association between late -- life social activity and motor decline in older adults. Achieves of Internal Medicine, 169 (12), 139-1146.

Donni, L., Savina, C., & Cannella, C. ( 2009). Nutrition in the elderly: Role of fiber. Archives of Gerontology and Geriatrics, 49, 61-69

Hassanein, S. & Narsavage, G. ( 2009). The does effect of pulmonary rehabilitation of physical activity, perceived exertion, and quality of life. Journal of Cardiopulmonary Rehabilitation and Prevention. 29 (4), 255-260.